LL-37: Uses, Benefits & Research

What is LL-37?

LL-37 is the only human cathelicidin antimicrobial peptide, a 37-amino acid alpha-helical peptide ([LL-37, 37 aa], MW approximately 4,500 Da) encoded by the CAMP gene. Unlike most peptides in the therapeutic space, LL-37 is an endogenous human peptide naturally produced by neutrophils, epithelial cells, mast cells, and sweat glands as part of the innate immune system.

This endogenous origin provides theoretical advantages: minimal immunogenicity, resistance to development of microbial resistance, and a supplementation rationale (adding to what the body already produces) rather than introducing a foreign compound. However, as of March 2026, LL-37 remains investigational with no FDA approval, limited commercial availability, and a clinical evidence base that has not advanced significantly beyond the initial translational studies from 2000-2014.

Mechanism of Action

LL-37 functions through multiple mechanisms. Its primary antimicrobial activity involves the alpha-helical peptide intercalating into bacterial membranes, creating ion channels that lead to bacterial cell death at micromolar concentrations. This direct bactericidal effect extends to viruses and fungi as well.

Beyond direct antimicrobial activity, LL-37 modulates innate immunity by influencing neutrophil, monocyte, and T-cell activity through FPR1 (formyl peptide receptor 1) for chemoattractant signaling and VPAC1/2 receptors for immunomodulatory effects. It promotes wound healing by stimulating keratinocyte and fibroblast migration and proliferation for re-epithelialization. Recent research (2022) has also shown LL-37 transports immunoreactive cGAMP to activate STING signaling for enhanced antiviral immunity.

LL-37 has a short circulating half-life of approximately 1 hour and is susceptible to protease degradation, which limits systemic delivery. Topical and inhaled routes have been most studied in humans.

Clinical Evidence

Human Studies

LL-37 has approximately 30-50 human studies total, including 0-1 RCTs, roughly 5 controlled studies, 20-30 observational studies, and several case reports.

Landmark Venous Leg Ulcer Trial (NCT00627731, PMID: 25041740): The most substantial human data comes from a randomized, double-blind, placebo-controlled trial of topical LL-37 (0.5% and 1.0% cream) in 34 patients with hard-to-heal venous leg ulcers over 12 weeks. Results showed statistically significant improvement in wound healing versus placebo. No serious adverse events were reported, with mild local irritation in 2 of 34 patients. This trial is promising but requires replication in larger studies.

Cystic Fibrosis Studies: Inhaled LL-37 (2.5-5 mg nebulized, twice daily) reduced infection markers in small observational studies of CF patients, with good tolerability.

Wound Healing Studies: Multiple small observational studies from the 2000s showed topical LL-37 improved re-epithelialization.

Preclinical Evidence

Recent preclinical work includes LL-37’s inhibition of SARS-CoV-2 infection via TMPRSS2 cleavage interference (2025), regulation of goblet cell mucus secretion (2025), LDL clearance promotion and cholesterol metabolism (2025), and antifungal activity characterization (2023).

Drug Interactions & Contraindications

No formal drug interaction studies have been conducted. Theoretical interactions include potential counteraction of immunosuppressive therapy (LL-37 activates innate immune pathways), synergistic antimicrobial effects with topical antibiotics, and additive effects with other antimicrobial peptides.

LL-37 is theoretically contraindicated in autoimmune conditions where immune activation could exacerbate disease. It should be avoided during pregnancy and breastfeeding due to lack of safety data. No specific interactions with MAT drugs are expected based on mechanism.

Safety & Side Effects

From the limited human trial data, LL-37 appears well-tolerated in topical application (mild local irritation in a small minority) and inhaled administration (no serious adverse events in CF patients). Systemic administration data is essentially absent.

Theoretical safety concerns include excessive immune stimulation from a potent immunomodulator, autoimmunity risk from aberrant immune responses, and off-target effects from multiple receptor interactions. These theoretical concerns have not been observed in the limited human trials conducted to date. Safety data is limited to small trials, and long-term safety beyond 12 weeks has not been established.

Honest Bottom Line

LL-37 is an endogenous human antimicrobial peptide with interesting biological activity and some promising early clinical data — most notably a small randomized trial showing improved wound healing in venous leg ulcers. However, the field has not advanced significantly beyond initial translational studies from 2000-2014. There are no large-scale Phase III trials, no established therapeutic protocols, and limited commercial availability. The distinction that LL-37 is a naturally occurring human peptide is scientifically interesting but does not constitute clinical evidence. Patients considering LL-37 should understand this is not an approved drug, dosing is not established, and the evidence base consists primarily of small early-phase studies requiring replication in larger trials.