VIP: Uses, Benefits & Research

Vasoactive Intestinal Peptide (VIP) is a 28-amino acid neuropeptide with 3-5 small RCTs across multiple indications. The synthetic formulation Aviptadil was studied under FDA IND for COVID-19 ARDS.

Investigational Emerging Research

VIP: At a Glance

VIP is an endogenous 28-amino acid neuropeptide that activates VPAC1 and VPAC2 receptors, triggering cAMP-mediated vasodilation, immunomodulation, and anti-inflammatory signaling. It reduces TNF-alpha and IL-6, promotes T regulatory cell function, and improves pulmonary vascular perfusion.

  • Improves respiratory function via pulmonary vasodilation
  • Anti-inflammatory effects reducing TNF-alpha and IL-6
  • Encouraging case series data in COVID-19 ARDS (Aviptadil)
  • Immunomodulatory properties via T regulatory cell promotion
  • Neuroprotective effects demonstrated in preclinical models
  • Multiple routes studied in humans (IV, inhaled, subcutaneous)
  • Hypotension — dose-dependent, primary safety concern
  • Facial and body flushing
  • Nausea
  • Diarrhea at high doses
  • Reflex tachycardia
Investigational Emerging Research

Research Summary

VIP is a 28-amino acid neuropeptide with broad physiological effects including immunomodulation, neuroprotection, and anti-inflammatory activities. Research demonstrates promising results in neurodegenerative diseases, inflammatory bowel disease, and respiratory conditions through VPAC1/VPAC2 receptor signaling.

Considering VIP?

Find a verified provider who can evaluate whether VIP is appropriate for your situation.

Find a Provider

What is VIP?

Vasoactive Intestinal Peptide (VIP) is an endogenous 28-amino acid neuropeptide (HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, MW 3,326 Da) widely distributed throughout the nervous and immune systems. Initially discovered in the gut, VIP is now known to have widespread physiological effects including vasodilation, immune regulation, and neurotransmission.

VIP has two distinct research trajectories: (1) the Shoemaker CIRS/mold illness protocol, which is considered controversial and not validated by mainstream medicine, and (2) the Aviptadil COVID-19 ARDS research, where the synthetic VIP formulation was studied under FDA IND (Investigational New Drug) status. Despite approximately 30-50 human studies and 3-5 small RCTs, no indication has achieved FDA approval. VIP has a very short IV half-life (1-2 minutes) and approximately 15-minute subcutaneous half-life, with poor oral bioavailability.

Mechanism of Action

VIP acts on two primary G-protein coupled receptors: VPAC1 (expressed in lungs, liver, immune cells) and VPAC2 (expressed in CNS, pancreas, immune cells). Both signal through Gs-alpha to increase cAMP, producing vasodilation, immune modulation, and anti-inflammatory effects.

Key downstream effects include reduction of pro-inflammatory cytokines (TNF-alpha, IL-6), promotion of T regulatory cell function for immune tolerance, pulmonary vasodilation for improved oxygenation, and protection of alveolar type II cells (relevant to COVID-19 research).

For COVID-19 ARDS, the hypothesis was that VIP could protect alveolar type II cells (primary SARS-CoV-2 targets), reduce cytokine storm, improve pulmonary vascular perfusion, and support surfactant production.

Clinical Evidence

Human Studies

VIP has approximately 30-50 human studies including 3-5 small RCTs with mixed results across indications.

Ulcerative Colitis RCT (2000s): Randomized trial (N approximately 100) showed mixed results with no significant benefit over placebo (PMID: 15655245).

Asthma RCT (2000s): Trial (N approximately 80) showed no significant benefit for respiratory outcomes.

Aviptadil COVID-19 ARDS Trial (NCT04311697): Prospective, open-label, administratively-controlled trial (N approximately 120) of IV Aviptadil in critical COVID-19 with respiratory failure showed rapid clinical recovery in some patients. However, this was not a traditional blinded RCT, and results require confirmation in properly designed trials (PMID: PMC8735760).

CIRS/Shoemaker Protocol: VIP (300-400 IU subcutaneous) used in the Shoemaker protocol for mold/biotoxin illness. Evidence is primarily observational and not validated by mainstream medicine. This protocol is considered controversial and investigational.

Preclinical Evidence

Recent preclinical work includes VIP overexpression protecting cognitive function after anesthesia/surgery (2025), VIP-stimulated macrophage anti-SARS-CoV-2 activity via NF-kB modulation (2024), VIP receptor expression changes in multiple sclerosis brain tissue (2024), and exogenous VIP reducing inflammatory responses and improving intestinal barrier integrity (2024).

Drug Interactions & Contraindications

Antihypertensives have a documented additive hypotensive interaction with VIP's vasodilatory effects. Theoretical interactions include phosphodiesterase inhibitors (VIP signals via cAMP), other vasodilators, immunosuppressants, and corticosteroids (potential synergistic anti-inflammatory effects).

VIP is contraindicated in hypotension or hemodynamic instability (primary safety concern due to vasodilatory effects) and during pregnancy/breastfeeding. Blood pressure monitoring is required during administration. Caution is advised with any drug affecting blood pressure.

Safety & Side Effects

From human trials across multiple indications, the primary safety concern is dose-dependent hypotension due to VPAC1/VPAC2-mediated vasodilation. Other reported effects include facial and body flushing, nausea, diarrhea at high doses, and reflex tachycardia.

In the ulcerative colitis and asthma trials (combined N approximately 180), VIP was generally safe with hypotension as the dose-limiting factor. In the COVID-19 trial (N approximately 120), VIP was well-tolerated with managed hypotension. Theoretical concerns include arrhythmias, immune suppression, and cellular proliferation effects, though these have not been observed at therapeutic doses in trials.

Honest Bottom Line

VIP is a neuropeptide with legitimate biological activity and clinical investigation spanning multiple indications, but no indication has achieved FDA approval. The evidence base consists of 3-5 small RCTs with mixed results. Two distinct research trajectories exist: the controversial Shoemaker CIRS protocol (not validated by mainstream medicine) and the more rigorous Aviptadil COVID-19 ARDS research (encouraging case series data but not yet sufficient for approval).

The CIRS protocol lacks robust clinical validation and is based on observational data. The COVID-19 data requires confirmation in properly blinded trials. VIP is not a proven therapeutic for any condition as of March 2026. Patients should be particularly cautious about pursuing the CIRS protocol outside of clinical trials, and blood pressure monitoring is essential with any VIP administration due to the hypotension risk.

Drug Interaction Checker

References

  1. 1

    Overexpression of colonic VIP ameliorates cognitive function and barrier system damage caused by sevoflurane anesthesia and surgery in aged rats with fragile brain functions.

    Liao H, Wang X, Yang C, Wang Z, Liu X, et al.

    Experimental neurology 2025 study
  2. 2

    Increased Expression of the Neuropeptides PACAP/VIP in the Brain of Mice with CNS Targeted Production of IL-6 Is Mediated in Part by Trans-Signalling.

    Castorina A, Scheller J, Keay KA, Marzagalli R, Rose-John S, et al.

    International journal of molecular sciences 2024 study
  3. 3

    Differential Expression of PACAP/VIP Receptors in the Post-Mortem CNS White Matter of Multiple Sclerosis Donors.

    Jansen MI, Musumeci G, Castorina A

    International journal of molecular sciences 2024 study
  4. 4

    Targeting the PAC1 receptor mitigates degradation of myelin and synaptic markers and diminishes locomotor deficits in the cuprizone demyelination model.

    Jansen MI, Mahmood Y, Lee J, Broome ST, Waschek JA, et al.

    Journal of neurochemistry 2024 study
  5. 5

    Extracellular vesicles from primary human macrophages stimulated with VIP or PACAP mediate anti-SARS-CoV-2 activities in monocytes through NF-kB signaling pathway.

    Arteaga-Blanco LA, Temerozo JR, Tiné LPS, Dantas-Pereira L, Sacramento CQ, et al.

    Microbes and infection 2024 study
  6. 6

    The impact of exogenous vasoactive intestinal polypeptide on inflammatory responses and mRNA expression of tight junction genes in lambs fed a high-grain diet.

    Mia GK, Hawley E, Yusuf M, Amat S, Ward AK, et al.

    Journal of animal science 2024 study
  7. 7

    VIP in ulcerative colitis RCT.

    2005 clinical trial

Next Step

Find a VIP Provider

Search verified providers offering VIP therapy. Compare credentials, read reviews, and book a consultation.