VIP: Uses, Benefits & Research

What is VIP?

Vasoactive Intestinal Peptide (VIP) is an endogenous 28-amino acid neuropeptide (HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, MW 3,326 Da) widely distributed throughout the nervous and immune systems. Initially discovered in the gut, VIP is now known to have widespread physiological effects including vasodilation, immune regulation, and neurotransmission.

VIP has two distinct research trajectories: (1) the Shoemaker CIRS/mold illness protocol, which is considered controversial and not validated by mainstream medicine, and (2) the Aviptadil COVID-19 ARDS research, where the synthetic VIP formulation was studied under FDA IND (Investigational New Drug) status. Despite approximately 30-50 human studies and 3-5 small RCTs, no indication has achieved FDA approval. VIP has a very short IV half-life (1-2 minutes) and approximately 15-minute subcutaneous half-life, with poor oral bioavailability.

Mechanism of Action

VIP acts on two primary G-protein coupled receptors: VPAC1 (expressed in lungs, liver, immune cells) and VPAC2 (expressed in CNS, pancreas, immune cells). Both signal through Gs-alpha to increase cAMP, producing vasodilation, immune modulation, and anti-inflammatory effects.

Key downstream effects include reduction of pro-inflammatory cytokines (TNF-alpha, IL-6), promotion of T regulatory cell function for immune tolerance, pulmonary vasodilation for improved oxygenation, and protection of alveolar type II cells (relevant to COVID-19 research).

For COVID-19 ARDS, the hypothesis was that VIP could protect alveolar type II cells (primary SARS-CoV-2 targets), reduce cytokine storm, improve pulmonary vascular perfusion, and support surfactant production.

Clinical Evidence

Human Studies

VIP has approximately 30-50 human studies including 3-5 small RCTs with mixed results across indications.

Ulcerative Colitis RCT (2000s): Randomized trial (N approximately 100) showed mixed results with no significant benefit over placebo (PMID: 15655245).

Asthma RCT (2000s): Trial (N approximately 80) showed no significant benefit for respiratory outcomes.

Aviptadil COVID-19 ARDS Trial (NCT04311697): Prospective, open-label, administratively-controlled trial (N approximately 120) of IV Aviptadil in critical COVID-19 with respiratory failure showed rapid clinical recovery in some patients. However, this was not a traditional blinded RCT, and results require confirmation in properly designed trials (PMID: PMC8735760).

CIRS/Shoemaker Protocol: VIP (300-400 IU subcutaneous) used in the Shoemaker protocol for mold/biotoxin illness. Evidence is primarily observational and not validated by mainstream medicine. This protocol is considered controversial and investigational.

Preclinical Evidence

Recent preclinical work includes VIP overexpression protecting cognitive function after anesthesia/surgery (2025), VIP-stimulated macrophage anti-SARS-CoV-2 activity via NF-kB modulation (2024), VIP receptor expression changes in multiple sclerosis brain tissue (2024), and exogenous VIP reducing inflammatory responses and improving intestinal barrier integrity (2024).

Drug Interactions & Contraindications

Antihypertensives have a documented additive hypotensive interaction with VIP’s vasodilatory effects. Theoretical interactions include phosphodiesterase inhibitors (VIP signals via cAMP), other vasodilators, immunosuppressants, and corticosteroids (potential synergistic anti-inflammatory effects).

VIP is contraindicated in hypotension or hemodynamic instability (primary safety concern due to vasodilatory effects) and during pregnancy/breastfeeding. Blood pressure monitoring is required during administration. Caution is advised with any drug affecting blood pressure.

Safety & Side Effects

From human trials across multiple indications, the primary safety concern is dose-dependent hypotension due to VPAC1/VPAC2-mediated vasodilation. Other reported effects include facial and body flushing, nausea, diarrhea at high doses, and reflex tachycardia.

In the ulcerative colitis and asthma trials (combined N approximately 180), VIP was generally safe with hypotension as the dose-limiting factor. In the COVID-19 trial (N approximately 120), VIP was well-tolerated with managed hypotension. Theoretical concerns include arrhythmias, immune suppression, and cellular proliferation effects, though these have not been observed at therapeutic doses in trials.

Honest Bottom Line

VIP is a neuropeptide with legitimate biological activity and clinical investigation spanning multiple indications, but no indication has achieved FDA approval. The evidence base consists of 3-5 small RCTs with mixed results. Two distinct research trajectories exist: the controversial Shoemaker CIRS protocol (not validated by mainstream medicine) and the more rigorous Aviptadil COVID-19 ARDS research (encouraging case series data but not yet sufficient for approval).

The CIRS protocol lacks robust clinical validation and is based on observational data. The COVID-19 data requires confirmation in properly blinded trials. VIP is not a proven therapeutic for any condition as of March 2026. Patients should be particularly cautious about pursuing the CIRS protocol outside of clinical trials, and blood pressure monitoring is essential with any VIP administration due to the hypotension risk.